Howdy, Stranger!

It looks like you're new here. If you want to get involved, click one of these buttons!

Let's Write a Story

1679111217

Comments

  • wyvexwyvex Member UncommonPosts: 346

    for breakfast,lunch,dinner

    image

  • RenithRenith Member Posts: 145

    , but not for cocopuffs.

  • b0rderline99b0rderline99 Member Posts: 1,441

    on my giant

  • AkaJetsonAkaJetson Member Posts: 1,167

    tongue was

    ?

  • 8hammer88hammer8 Member Posts: 1,812

    ever present.

    "It is easier to be cruel than wise. The road to wisdom is long and difficult... so most people just turn out to be assholes" Feng (Christopher Walken)

  • b0rderline99b0rderline99 Member Posts: 1,441

    to amphibian

  • RespyShuntRespyShunt Member Posts: 396

    took a poop

    image
    image
    image

  • AkaJetsonAkaJetson Member Posts: 1,167

    whilst peeing.

    ?

  • wyvexwyvex Member UncommonPosts: 346

    in his eye

    image

  • AkaJetsonAkaJetson Member Posts: 1,167

    was a tear

    ?

  • AguyAguy Member Posts: 561

    which revealed the

  • AkaJetsonAkaJetson Member Posts: 1,167

    pain he

    ?

  • AguyAguy Member Posts: 561

    had been feeling since the

  • AguyAguy Member Posts: 561

    was nearly suffocated by Rosie O' Donell.

     

    Sorry for posting more then 2 words.

  • AguyAguy Member Posts: 561

    her incredibly huge

  • wyvexwyvex Member UncommonPosts: 346

    Vagina over

    image

  • raygunraygun Member Posts: 49

    its face

  • b0rderline99b0rderline99 Member Posts: 1,441

    of cheetoes

  • RespyShuntRespyShunt Member Posts: 396

    italian sausage

    image
    image
    image

  • AkaJetsonAkaJetson Member Posts: 1,167

    . Rosie died while

    ?

  • AkaJetsonAkaJetson Member Posts: 1,167

    Once upon the end of a great era there [were] 2 monkeys spanking humans with bananas.  Cannibal pygmies, Hung like ( [as] in William Hung) song debut in trees, failed miserably. Then suddenly, Chuck Norris killed 9,000 randy dolphins. So I touched myself in places only a turtle would think of going. Who would ever think that to cure cancer, a testicle's fresh breathe would require spontanious decapitation with a rusty chainsaw. Sadly there were only two bandaids I used where my head used to reside. But glory only led to flatulence. But since cancer is completely prone to nothing really.

    Everyone knows I'm sexy. I eat worlds, and mom's oddly shaped secret toys (vibrating toys.) 4,000 different shapes and sizes of pleasurable goodness. The world of porn makes me really hawt and President Bush looked at j00r m0th3r and screamed "Gafilta fish!" and "ZOMG!"

    Batman boofed Robin all over and yelled "Sucky suck, $5." Then turned to me and whispered  "Nice penis." I thought "enough quotations!" and killed AkaJetson 10 with your pet lobster of +5 stamina. "Fire bolt! FIRE BOLT!" it cried! The lobster was gay bashing so I left the house lights on, when suddenly, everybody stripped their wallpaper by breathing toxic gasses.

    When is my cat pumping iron? He-Man then ate some food which he though was repulsive and experienced NGE.  Domestic capacity of Bush is very insane because this thread continues to ramble on.  And the end of this thread will never result in anything decent but cheese.   The moon is not made of a describable substance called queso azul.

    However, the dehydrated T-Rex farted loudly then turned back and ended this story, but then SOE haters farted loudly hoping Pre-CU will never hopelessly bore Prehistoric midgets with potatoguns (twirling mustaches of spam).  Endangered spaminals will end sex[ed] up and down in places.  Austropithicus likely sleep in my house with mom.

    Michael Jackson killed his favorite monkey because it touched his nose of, Will Wright also died. He was Re-born and exclaimed " I can't die!". But he did finally finish spore and he would eat that OREO but he didn't. And so I travel to Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu.

    Then suddenly Pirateer got eaten by a shark at Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit where the oompa loompa opened up a box of pastey white residue of chocolate rain from the chocolate sky which Angus Young eloped with George Bush who pulled seventeen NPC's out of squishy jelly.

    Jelly monster of doom saw (that) Vendayn was dealing with Angus Young who we know enjoys chess, like he enjoys eating jelly. On Tuesday in Bangkok for breakfast, lunch, dinner, SOE also but not for cocopuffs.

    Chocolate goodness on my tongue was ever present. To Amphibian took a poop whilst peeing. In his eye was a tear which revealed the pain he had been feeling since the day he was nearly suffocated by Rosie O' Donell. Rosie O' Donell stuck her incredibly huge vagina over its face of cheetoes and mouldy Italian sausage. Rosie died while

     

    ?

  • PunkMonkPunkMonk Member Posts: 483

    Playing a

    image

    image

  • AkaJetsonAkaJetson Member Posts: 1,167

    MMORPG called

    ?

  • b0rderline99b0rderline99 Member Posts: 1,441

    z0mg im 1337

  • Manson_FanManson_Fan Member Posts: 46

    but not really

Sign In or Register to comment.